HORDB

ID: hor006263
Uniprot ID: Q16661
Protein name: Uroguanylin
Gene name: GUCA2B
Organism: Homo sapiens (Human)
Family: Guanylin family
Source: Human
Expression: Stomach and intestine.
Disease: Diseases associated with GUCA2B include Cataract 8, Multiple Types and Colorectal Cancer.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005515 protein binding; GO:0030250 guanylate cyclase activator activity
GO BP: GO:0019934 cGMP-mediated signaling
GO CC: GO:0005576 extracellular region; GO:0070062 extracellular exosome

Sequence: NDDCELCVNVACTGCL
Length: 16
Propeptide: MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Signal peptide: MGCRAASGLLPGVAVVLLLLLQSTQS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

1uya.pdb

hor006263_AF2.pdb

hor006263_ESM.pdb

Mass:	193966	Formula:	C64H106N18O26S4
Absent amino acids:	FHIKMPQRSWY	Common amino acids:	C
pI:	3.38	Basic residues:	0
Polar residues:	8	Hydrophobic residues:	5
Hydrophobicity:	57.5	Boman Index:	-1431
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	91.25
Instability Index:	5923.13	Extinction Coefficient cystines:	250
Absorbance 280nm:	16.67

PubMed ID: 8605041
Title: Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.
PubMed ID: 8519795
Title: A new human guanylate cyclase-activating peptide (GCAP-II, uroguanylin): precursor cDNA and colonic expression.
PubMed ID: 9268639
Title: Genomic structure and chromosomal localization of human uroguanylin.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 7589507
Title: GCAP-II: isolation and characterization of the circulating form of human uroguanylin.
PubMed ID: 8141334
Title: Characterization of human uroguanylin: a member of the guanylin peptide family.
PubMed ID: 9774236
Title: One peptide, two topologies: structure and interconversion dynamics of human uroguanylin isomers.